PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G055400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NAC
Protein Properties Length: 417aa    MW: 47220.3 Da    PI: 6.96
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G055400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1645.2e-51151431128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatg 87 
                          +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg
  Manes.01G055400.1.p  15 VPPGFRFHPTEEELLHYYLRKKVAYEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATG 103
                          69****************************.9***************964444222455******************************* PP

                  NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +dk ++s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Manes.01G055400.1.p 104 RDKIIYS-GFRRIGLRKTLVFYKGRAPRGQKSDWIMHEYRL 143
                          *******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-579173IPR003441NAC domain
PROSITE profilePS5100556.68615173IPR003441NAC domain
PfamPF023651.2E-2616143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGHDMNFSIN GQSQVPPGFR FHPTEEELLH YYLRKKVAYE KIDLDVIREV DLNKLEPWDI  60
QEKCKIGSTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKIIYS GFRRIGLRKT  120
LVFYKGRAPR GQKSDWIMHE YRLDDSSHET TDSNPIGEAI PEEGWVVCRV FRKKNYHKTL  180
GSPKGSSSSM DSKTQILSSG NDGVLDQLLL YMGKTCKLES ESLSHMNQSN ISRYMSVRFL  240
SSNNSGISEG AHESYMHLPR LDSPTLPSLT VSSPSFDQES NFKSCYQPYD EMFTENNELS  300
STTNHHHHHR QDKGFMTSIQ ENNKSGLNDW ATFDRLVASQ LDGHAVETSK QLSCFSDPNG  360
SFGLSPDDGM QLSHLHVHSD RSNQANSQVY SSENDLWSFT NSSSPSSSNP LCHLSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-5011751170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR6052280.0KR605228.1 Manihot esculenta NAC transcription factors 90 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518924.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-117NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0M4FBT80.0A0A0M4FBT8_MANES; NAC transcription factors 90
STRINGPOPTR_0011s15640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-101NAC family protein
Publications ? help Back to Top
  1. Hu W, et al.
    Genome-Wide Identification and Expression Analysis of the NAC Transcription Factor Family in Cassava.
    PLoS ONE, 2015. 10(8): p. e0136993
    [PMID:26317631]